PDB entry 1gzn

View 1gzn on RCSB PDB site
Description: structure of pkb kinase domain
Class: kinase
Keywords: kinase, transferase, serine/threonine-protein kinase, ATP-binding
Deposited on 2002-05-24, released 2003-05-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.268
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rac-beta serine/threonine protein kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gzna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gznA (A:)
    kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
    ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
    lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
    dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
    kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
    qsititppdrydslglleldqrthfpqfsysasir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gznA (A:)
    kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkevivtesrvlqntrhpflta
    lkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaleylhsrdvvyr
    diklenlmldkdghikitdfgltpeylapevledndygravdwwglgvvmyemmcgrlpf
    ynqdherlfelilmeeirfprtlspeaksllagllkkdpkqrlgggpsdakevmehrffl
    sinwqdvvqkkllppfkpqvtsevdtryfdde