PDB entry 1gzl

View 1gzl on RCSB PDB site
Description: crystal structure of c14linkmid/iqn17: a cross-linked inhibitor of hiv-1 entry bound to the gp41 hydrophobic pocket
Class: glycoprotein
Keywords: hiv entry, inhibitor, cross-link, gp41, coiled coil
Deposited on 2002-05-23, released 2002-10-10
The last revision prior to the SCOP 1.75 freeze date was dated 2005-07-12, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.208
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fusion protein between the hydrophobic pocket of hiv gp41 and general control protein gcn4-piqi
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (0-27)
      • conflict (4)
      • conflict (8)
      • conflict (11-12)
      • conflict (15-18)
      • conflict (22)
      • conflict (25)
    • Uniprot P04578
    Domains in SCOP 1.75: d1gzl.1
  • Chain 'B':
    Compound: fusion protein between the hydrophobic pocket of hiv gp41 and general control protein gcn4-piqi
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (0-27)
      • conflict (4)
      • conflict (8)
      • conflict (11-12)
      • conflict (15-18)
      • conflict (22)
      • conflict (25)
    • Uniprot P04578
    Domains in SCOP 1.75: d1gzl.2
  • Chain 'C':
    Compound: envelope glycoprotein gp41
    Species: synthetic, synthetic
    Domains in SCOP 1.75: d1gzl.1
  • Chain 'D':
    Compound: envelope glycoprotein gp41
    Species: synthetic, synthetic
    Domains in SCOP 1.75: d1gzl.2
  • Heterogens: CL, ACE, N2P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gzlA (A:)
    rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gzlB (B:)
    rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gzlC (C:)
    weewdreienyt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gzlD (D:)
    weewdreienyt