PDB entry 1gzg

View 1gzg on RCSB PDB site
Description: complex of a mg2-dependent porphobilinogen synthase from pseudomonas aeruginosa (mutant d139n) with 5-fluorolevulinic acid
Deposited on 2002-05-21, released 2002-06-27
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-27, with a file datestamp of 2002-06-27.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.175
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1gzga_
  • Chain 'B':
    Domains in SCOP 1.61: d1gzgb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gzgA (A:)
    nraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverlsid
    qllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgiit
    dvaldpftthgqngildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgrigair
    ealesaghtnvrvmaysakyasayygpfrdavgsasnlgkgnkatyqmdpansdealhev
    aadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesvi
    lesltafkragadgiltyfakqaaeqlrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gzgB (B:)
    panraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverls
    idqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgi
    itdvaldpftthgqngildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgriga
    irealesaghtnvrvmaysakyasayygpfrdavgsasnlgkgnkatyqmdpansdealh
    evaadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaes
    vilesltafkragadgiltyfakqaaeqlrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gzgB (B:)
    panraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverls
    idqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgi
    itdvaldpftthgqngildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgriga
    irealesaghtnvrvmaysakyasayygpfrdavgskatyqmdpansdealhevaadlae
    gadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesvileslta
    fkragadgiltyfakqaaeqlrr