PDB entry 1gzc

View 1gzc on RCSB PDB site
Description: high-resolution crystal structure of erythrina cristagalli lectin in complex with lactose
Class: sugar binding protein
Keywords: lectin, carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein
Deposited on 2002-05-17, released 2002-06-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.208
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: erythrina crista-galli lectin
  Species: ERYTHRINA CRISTA-GALLI [TaxId:49817]
  Database cross-references and differences (RAF-indexed):
  • PDB 1GZC (0-238)
  Domains in SCOPe 2.04: d1gzca_
• Heterogens: MN, CA, LAT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gzcA (A:)
  vetisfsfsefepgndnltlqgaalitqsgvlqltkinqngmpawdstgrtlytkpvhmw
  dsttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
  yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydapskilh
  vvlvypssgaiytiaeivdvkqvlpdwvdvglsgatgaqrdaaethdvyswsfqaslpe