PDB entry 1gzc

View 1gzc on RCSB PDB site
Description: high-resolution crystal structure of erythrina cristagalli lectin in complex with lactose
Class: lectin
Keywords: legume lectin, glycobiology, protein, carbohydrate, saccharide, protein-carbohydrate interactions, crystal structure, lactose, glycoprotein
Deposited on 2002-05-17, released 2002-06-21
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.208
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: erythrina crista-galli lectin
    Species: Erythrina crista-galli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gzca_
  • Heterogens: LAT, MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gzcA (A:)
vetisfsfsefepgndnltlqgaalitqsgvlqltkinqngmpawdstgrtlytkpvhmw
dsttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydapskilh
vvlvypssgaiytiaeivdvkqvlpdwvdvglsgatgaqrdaaethdvyswsfqaslpe