PDB entry 1gzc

View 1gzc on RCSB PDB site
Description: high-resolution crystal structure of erythrina cristagalli lectin in complex with lactose
Deposited on 2002-05-17, released 2002-06-21
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-01, with a file datestamp of 2002-08-01.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.208
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1gzca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gzcA (A:)
vetisfsfsefepgndnltlqgaalitqsgvlqltkinqngmpawdstgrtlytkpvhmw
dsttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydapskilh
vvlvypssgaiytiaeivdvkqvlpdwvdvglsgatgaqrdaaethdvyswsfqaslpe