PDB entry 1gza

View 1gza on RCSB PDB site
Description: peroxidase
Class: oxidoreductase
Keywords: oxidoreductase, glycoprotein, peroxidase, heme
Deposited on 1996-11-13, released 1997-03-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.162
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxidase
    Species: 'Arthromyces ramosus' [TaxId:5451]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1gzaa_
  • Heterogens: CA, IOD, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gzaA (A:)
    qgpgggggsvtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaig
    fspaltaagqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqf
    atavgmsncpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdl
    laahslasqeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpge
    frmrsdallardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsa
    vsnnaapvipggltvddievscpsepfpeiatasgplpslapap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gzaA (A:)
    svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
    gqfggggadgsiiahsnielafpanggltdtiealravginhgvsfgdliqfatavgmsn
    cpgsprlefltgrsnssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
    qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
    lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
    ipggltvddievscpsepfpeiatasgplpslapap