PDB entry 1gz9

View 1gz9 on RCSB PDB site
Description: high-resolution crystal structure of erythrina cristagalli lectin in complex with 2'-alpha-l-fucosyllactose
Class: sugar binding protein
Keywords: lectin, fucosyllactose, sugar binding protein, protein-carbohydrate interactions, carbohydrate, glycoprotein, legume lectin
Deposited on 2002-05-17, released 2002-06-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.209
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: erythrina crista-galli lectin
    Species: ERYTHRINA CRISTA-GALLI [TaxId:49817]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GZ9 (0-238)
    Domains in SCOPe 2.01: d1gz9a_
  • Heterogens: MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gz9A (A:)
vetisfsfsefepgndnltlqgaalitqsgvlqltkinqngmpawdstgrtlytkpvhmw
dsttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydapskilh
vvlvypssgaiytiaeivdvkqvlpdwvdvglsgatgaqrdaaethdvyswsfqaslpe