PDB entry 1gz9

View 1gz9 on RCSB PDB site
Description: high-resolution crystal structure of erythrina cristagalli lectin in complex with 2'-alpha-l-fucosyllactose
Class: lectin
Keywords: glycobiology, crystal structure, fucosyllactose protein-carbohydrate interactions, protein, carbohydrate, saccharide, lactose, fucose, glycoprotein, legume lectin
Deposited on 2002-05-17, released 2002-06-21
The last revision prior to the SCOP 1.73 freeze date was dated 2002-08-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.209
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: erythrina crista-galli lectin
    Species: Erythrina crista-galli
    Database cross-references and differences (RAF-indexed):
    • PDB 1GZ9 (0-238)
    Domains in SCOP 1.73: d1gz9a_
  • Heterogens: MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gz9A (A:)
    vetisfsfsefepgndnltlqgaalitqsgvlqltkinqngmpawdstgrtlytkpvhmw
    dsttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydapskilh
    vvlvypssgaiytiaeivdvkqvlpdwvdvglsgatgaqrdaaethdvyswsfqaslpe