PDB entry 1gz4

View 1gz4 on RCSB PDB site
Description: molecular mechanism of the regulation of human mitochondrial nad(p)+-dependent malic enzyme by ATP and fumarate
Class: oxidoreductase
Keywords: allosteric regulation, energy metabolism, kinetics, oxidoreductase
Deposited on 2002-05-15, released 2002-07-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gz4a1, d1gz4a2
  • Chain 'B':
    Compound: NAD-dependent malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gz4b1, d1gz4b2
  • Chain 'C':
    Compound: NAD-dependent malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gz4c1, d1gz4c2
  • Chain 'D':
    Compound: NAD-dependent malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gz4d1, d1gz4d2
  • Heterogens: ATP, TTN, MN, FUM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gz4A (A:)
    ekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtspleky
    iyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdrgh
    vrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclpvc
    idvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnhna
    frflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgianl
    ivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavn
    ilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegrcl
    fasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsql
    tdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrsey
    dsllpdvyewp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gz4B (B:)
    ekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtspleky
    iyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdrgh
    vrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclpvc
    idvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnhna
    frflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgianl
    ivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavn
    ilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegrcl
    fasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsql
    tdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrsey
    dsllpdvyewp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gz4C (C:)
    ekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtspleky
    iyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdrgh
    vrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclpvc
    idvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnhna
    frflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgianl
    ivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavn
    ilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegrcl
    fasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsql
    tdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrsey
    dsllpdvyewp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gz4D (D:)
    ekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtspleky
    iyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdrgh
    vrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclpvc
    idvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnhna
    frflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgianl
    ivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavn
    ilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytltegrcl
    fasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsql
    tdeelaqgrlypplaniqevsiniaikvteylyankmafrypepedkakyvkertwrsey
    dsllpdvyewp