PDB entry 1gz3

View 1gz3 on RCSB PDB site
Description: molecular mechanism for the regulation of human mitochondrial nad(p)+-dependent malic enzyme by ATP and fumarate
Class: oxidoreductase
Keywords: allosteric regulation, energy metabolism, kinetics, oxidoreductase
Deposited on 2002-05-14, released 2003-05-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.194
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23368 (0-553)
      • engineered mutation (177)
      • engineered mutation (522)
      • engineered mutation (536)
    Domains in SCOPe 2.06: d1gz3a1, d1gz3a2
  • Chain 'B':
    Compound: NAD-dependent malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23368 (0-553)
      • engineered mutation (177)
      • engineered mutation (522)
      • engineered mutation (536)
    Domains in SCOPe 2.06: d1gz3b1, d1gz3b2
  • Chain 'C':
    Compound: NAD-dependent malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23368 (0-553)
      • engineered mutation (177)
      • engineered mutation (522)
      • engineered mutation (536)
    Domains in SCOPe 2.06: d1gz3c1, d1gz3c2
  • Chain 'D':
    Compound: NAD-dependent malic enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23368 (0-553)
      • engineered mutation (177)
      • engineered mutation (522)
      • engineered mutation (536)
    Domains in SCOPe 2.06: d1gz3d1, d1gz3d2
  • Heterogens: ATP, OXL, MN, FUM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gz3A (A:)
    hikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtspl
    ekyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisd
    rghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdqcl
    pvcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgn
    hnafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgi
    anlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfed
    avnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytlteg
    rclfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalt
    sqltdeelaqgrlypplaniqevsiniaikvteylyankmafvypepedkakyvkeqtwr
    seydsllpdvyewp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gz3B (B:)
    hikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtspl
    ekyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisd
    rghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdqcl
    pvcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgn
    hnafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgi
    anlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfed
    avnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytlteg
    rclfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalt
    sqltdeelaqgrlypplaniqevsiniaikvteylyankmafvypepedkakyvkeqtwr
    seydsllpdvyewp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gz3C (C:)
    hikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtspl
    ekyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisd
    rghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdqcl
    pvcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgn
    hnafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgi
    anlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfed
    avnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytlteg
    rclfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalt
    sqltdeelaqgrlypplaniqevsiniaikvteylyankmafvypepedkakyvkeqtwr
    seydsllpdvyewp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gz3D (D:)
    hikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtspl
    ekyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisd
    rghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdqcl
    pvcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgn
    hnafrflrkyrekyctfnddiqgtaavalagllaaqkviskpisehkilflgageaalgi
    anlivmsmvenglseqeaqkkiwmfdkygllvkgrkakidsyqepfthsapesipdtfed
    avnilkpstiigvagagrlftpdviramasinerpvifalsnptaqaectaeeaytlteg
    rclfasgspfgpvkltdgrvftpgqgnnvyifpgvalavilcntrhisdsvfleaakalt
    sqltdeelaqgrlypplaniqevsiniaikvteylyankmafvypepedkakyvkeqtwr
    seydsllpdvyewp