PDB entry 1gz2

View 1gz2 on RCSB PDB site
Description: crystal structure of the ovocleidin-17 a major protein of the gallus gallus eggshell calcified layer.
Class: sugar-binding protein
Keywords: structural protein, ctld, eggshell structural protein, phosphoprotein, sugar-binding protein, glycoprotein, lectin
Deposited on 2002-05-13, released 2003-05-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.2
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ovocleidin-17
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1gz2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gz2A (A:)
    dpdgcgpgwvptpggclgffsrelswsraesfcrrwgpgshlaavrsaaelrllaellna
    srggdgsgegadgrvwiglhrpagsrswrwsdgtaprfaswhrtakarrggrcaalrdee
    aftswaarpcternafvckaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gz2A (A:)
    gcgpgwvptpggclgffsrelswsraesfcrrwgpgshlaavrsaaelrllaellnasrg
    gdgsgegadgrvwiglhrpagsrswrwsdgtaprfaswhrtakarrggrcaalrdeeaft
    swaarpcternafvckaaa