PDB entry 1gz0

View 1gz0 on RCSB PDB site
Description: 23s ribosomal RNA g2251 2'o-methyltransferase rlmb
Class: transferase
Keywords: transferase, methyltransferase, 2'o-methyltransferase, knot, montreal- kingston bacterial structural genomics initiative, bsgi, structural genomics
Deposited on 2002-05-03, released 2002-10-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.231
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical tRNA/rRNA methyltransferase yjfh
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GZ0
    • Uniprot P39290 (Start-252)
    Domains in SCOPe 2.06: d1gz0a1, d1gz0a2
  • Chain 'B':
    Compound: hypothetical tRNA/rRNA methyltransferase yjfh
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GZ0 (Start-9)
    • Uniprot P39290 (10-252)
    Domains in SCOPe 2.06: d1gz0b1, d1gz0b2, d1gz0b3
  • Chain 'C':
    Compound: hypothetical tRNA/rRNA methyltransferase yjfh
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GZ0
    • Uniprot P39290 (Start-252)
    Domains in SCOPe 2.06: d1gz0c1, d1gz0c2
  • Chain 'D':
    Compound: hypothetical tRNA/rRNA methyltransferase yjfh
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GZ0 (Start-9)
    • Uniprot P39290 (10-252)
    Domains in SCOPe 2.06: d1gz0d1, d1gz0d2, d1gz0d3
  • Chain 'E':
    Compound: hypothetical tRNA/rRNA methyltransferase yjfh
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GZ0
    • Uniprot P39290 (Start-252)
    Domains in SCOPe 2.06: d1gz0e1
  • Chain 'F':
    Compound: hypothetical tRNA/rRNA methyltransferase yjfh
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GZ0 (0-9)
    • Uniprot P39290 (10-252)
    Domains in SCOPe 2.06: d1gz0f1, d1gz0f2, d1gz0f3
  • Chain 'G':
    Compound: hypothetical tRNA/rRNA methyltransferase yjfh
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GZ0
    • Uniprot P39290 (Start-252)
    Domains in SCOPe 2.06: d1gz0g1
  • Chain 'H':
    Compound: hypothetical tRNA/rRNA methyltransferase yjfh
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GZ0 (Start-9)
    • Uniprot P39290 (10-252)
    Domains in SCOPe 2.06: d1gz0h1, d1gz0h2, d1gz0h3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gz0A (A:)
    ssglvprgshmsemiygihavqalleraperfqevfilkgredkrllplihalesqgvvi
    qlanrqyldeksdgavhqgiiarvkpgrqyqendlpdliasldqpfllildgvtdphnlg
    aclrsadaagvhavivpkdrsaqlnatakkvacgaaesvplirvtnlartmrmlqeeniw
    ivgtageadhtlyqskmtgrlalvmgaegegmrrltrehcdelisipmagsvsslnvsva
    tgiclfeavrqrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gz0A (A:)
    semiygihavqalleraperfqevfilkgredkrllplihalesqgvviqlanrqyldek
    sdgavhqgiiarvkpgrqyqendlpdliasldqpfllildgvtdphnlgaclrsadaagv
    havivpkdrsaqlnatakkvacgaaesvplirvtnlartmrmlqeeniwivgtageadht
    lyqskmtgrlalvmgaegegmrrltrehcdelisipmagsvsslnvsvatgiclfeavrq
    rs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gz0B (B:)
    ssglvprgshmsemiygihavqalleraperfqevfilkgredkrllplihalesqgvvi
    qlanrqyldeksdgavhqgiiarvkpgrqyqendlpdliasldqpfllildgvtdphnlg
    aclrsadaagvhavivpkdrsaqlnatakkvacgaaesvplirvtnlartmrmlqeeniw
    ivgtageadhtlyqskmtgrlalvmgaegegmrrltrehcdelisipmagsvsslnvsva
    tgiclfeavrqrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gz0B (B:)
    hmsemiygihavqalleraperfqevfilkgredkrllplihalesqgvviqlanrqyld
    eksdgavhqgiiarvkpgrqyqendlpdliasldqpfllildgvtdphnlgaclrsadaa
    gvhavivpkdrsaqlnatakkvacgaaesvplirvtnlartmrmlqeeniwivgtagead
    htlyqskmtgrlalvmgaegegmrrltrehcdelisipmagsvsslnvsvatgiclfeav
    rqrs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gz0C (C:)
    ssglvprgshmsemiygihavqalleraperfqevfilkgredkrllplihalesqgvvi
    qlanrqyldeksdgavhqgiiarvkpgrqyqendlpdliasldqpfllildgvtdphnlg
    aclrsadaagvhavivpkdrsaqlnatakkvacgaaesvplirvtnlartmrmlqeeniw
    ivgtageadhtlyqskmtgrlalvmgaegegmrrltrehcdelisipmagsvsslnvsva
    tgiclfeavrqrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gz0C (C:)
    semiygihavqalleraperfqevfilkgredkrllplihalesqgvviqlanrqyldek
    sdgavhqgiiarvkpgrqyqendlpdliasldqpfllildgvtdphnlgaclrsadaagv
    havivpkdrsaqlnatakkvacgaaesvplirvtnlartmrmlqeeniwivgtageadht
    lyqskmtgrlalvmgaegegmrrltrehcdelisipmagsvsslnvsvatgiclfeavrq
    rs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gz0D (D:)
    ssglvprgshmsemiygihavqalleraperfqevfilkgredkrllplihalesqgvvi
    qlanrqyldeksdgavhqgiiarvkpgrqyqendlpdliasldqpfllildgvtdphnlg
    aclrsadaagvhavivpkdrsaqlnatakkvacgaaesvplirvtnlartmrmlqeeniw
    ivgtageadhtlyqskmtgrlalvmgaegegmrrltrehcdelisipmagsvsslnvsva
    tgiclfeavrqrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gz0D (D:)
    hmsemiygihavqalleraperfqevfilkgredkrllplihalesqgvviqlanrqyld
    eksdgavhqgiiarvkpgrqyqendlpdliasldqpfllildgvtdphnlgaclrsadaa
    gvhavivpkdrsaqlnatakkvacgaaesvplirvtnlartmrmlqeeniwivgtagead
    htlyqskmtgrlalvmgaegegmrrltrehcdelisipmagsvsslnvsvatgiclfeav
    rqrs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1gz0E (E:)
    ssglvprgshmsemiygihavqalleraperfqevfilkgredkrllplihalesqgvvi
    qlanrqyldeksdgavhqgiiarvkpgrqyqendlpdliasldqpfllildgvtdphnlg
    aclrsadaagvhavivpkdrsaqlnatakkvacgaaesvplirvtnlartmrmlqeeniw
    ivgtageadhtlyqskmtgrlalvmgaegegmrrltrehcdelisipmagsvsslnvsva
    tgiclfeavrqrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gz0E (E:)
    rqyqendlpdliasldqpfllildgvtdphnlgaclrsadaagvhavivpkdrsaqlnat
    akkvacgaaesvplirvtnlartmrmlqeeniwivgtageadhtlyqskmtgrlalvmga
    egegmrrltrehcdelisipmagsvsslnvsvatgiclfeavrqrs
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gz0F (F:)
    ssglvprgshmsemiygihavqalleraperfqevfilkgredkrllplihalesqgvvi
    qlanrqyldeksdgavhqgiiarvkpgrqyqendlpdliasldqpfllildgvtdphnlg
    aclrsadaagvhavivpkdrsaqlnatakkvacgaaesvplirvtnlartmrmlqeeniw
    ivgtageadhtlyqskmtgrlalvmgaegegmrrltrehcdelisipmagsvsslnvsva
    tgiclfeavrqrs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1gz0G (G:)
    ssglvprgshmsemiygihavqalleraperfqevfilkgredkrllplihalesqgvvi
    qlanrqyldeksdgavhqgiiarvkpgrqyqendlpdliasldqpfllildgvtdphnlg
    aclrsadaagvhavivpkdrsaqlnatakkvacgaaesvplirvtnlartmrmlqeeniw
    ivgtageadhtlyqskmtgrlalvmgaegegmrrltrehcdelisipmagsvsslnvsva
    tgiclfeavrqrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gz0G (G:)
    rqyqendlpdliasldqpfllildgvtdphnlgaclrsadaagvhavivpkdrsaqlnat
    akkvacgaaesvplirvtnlartmrmlqeeniwivgtageadhtlyqskmtgrlalvmga
    egegmrrltrehcdelisipmagsvsslnvsvatgiclfeavrqrs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1gz0H (H:)
    ssglvprgshmsemiygihavqalleraperfqevfilkgredkrllplihalesqgvvi
    qlanrqyldeksdgavhqgiiarvkpgrqyqendlpdliasldqpfllildgvtdphnlg
    aclrsadaagvhavivpkdrsaqlnatakkvacgaaesvplirvtnlartmrmlqeeniw
    ivgtageadhtlyqskmtgrlalvmgaegegmrrltrehcdelisipmagsvsslnvsva
    tgiclfeavrqrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gz0H (H:)
    lvprgshmsemiygihavqalleraperfqevfilkgredkrllplihalesqgvviqla
    nrqyldeksdgavhqgiiarvkpgrqyqendlpdliasldqpfllildgvtdphnlgacl
    rsadaagvhavivpkdrsaqlnatakkvacgaaesvplirvtnlartmrmlqeeniwivg
    tageadhtlyqskmtgrlalvmgaegegmrrltrehcdelisipmagsvsslnvsvatgi
    clfeavrqrs