PDB entry 1gyw

View 1gyw on RCSB PDB site
Description: gamma-adaptin appendage domain from clathrin adaptor ap1 a753d mutant
Class: endocytosis
Keywords: endocytosis, adaptor, coated pits
Deposited on 2002-04-30, released 2002-08-22
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.19034
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adapter-related protein complex 1 gamma 1 subunit
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22892 (Start-127)
      • engineered mutation (58)
    Domains in SCOP 1.73: d1gywa_
  • Chain 'B':
    Compound: adapter-related protein complex 1 gamma 1 subunit
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22892 (0-127)
      • engineered mutation (58)
    Domains in SCOP 1.73: d1gywb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gywA (A:)
    plfndiapgipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqadv
    pktfqlqllspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevn
    nfppqswq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gywA (A:)
    fndiapgipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqadvpk
    tfqlqllspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnf
    ppqswq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gywB (B:)
    plfndiapgipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqadv
    pktfqlqllspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevn
    nfppqswq