PDB entry 1gyw

View 1gyw on RCSB PDB site
Description: gamma-adaptin appendage domain from clathrin adaptor ap1 a753d mutant
Deposited on 2002-04-30, released 2002-08-22
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-22, with a file datestamp of 2002-08-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.19034
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1gywa_
  • Chain 'B':
    Domains in SCOP 1.61: d1gywb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gywA (A:)
    fndiapgipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqadvpk
    tfqlqllspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnf
    ppqswq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gywB (B:)
    plfndiapgipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqadv
    pktfqlqllspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevn
    nfppqswq