PDB entry 1gyv

View 1gyv on RCSB PDB site
Description: gamma-adaptin appendage domain from clathrin adaptor ap1, l762e mutant
Class: endocytosis
Keywords: endocytosis, adaptor, clathrin, golgi, adaptin
Deposited on 2002-04-30, released 2002-08-22
The last revision prior to the SCOP 1.73 freeze date was dated 2002-08-22, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.18231
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adapter-related protein complex 1 gamma 1 subunit
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22892 (0-0)
      • engineered mutation (59)
    • Uniprot P22892 (1-119)
    Domains in SCOP 1.73: d1gyva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyvA (A:)
    mipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfqlqe
    lspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppqswq