PDB entry 1gyu

View 1gyu on RCSB PDB site
Description: gamma-adaptin appendage domain from clathrin adaptor ap1
Class: endocytosis
Keywords: clathrin, golgi, adaptin, endocytosis, adaptor
Deposited on 2002-04-30, released 2002-08-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.18
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adapter-related protein complex 1 gamma 1 subunit
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1GYU (Start-20)
    • Uniprot P22892 (21-139)
    Domains in SCOPe 2.06: d1gyua1, d1gyua2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gyuA (A:)
    mgsshhhhhhssglvprgshmipsitaysknglkieftfersntnpsvtvitiqasnste
    ldmtdfvfqaavpktfqlqllspsssvvpafntgtitqvikvlnpqkqqlrmrikltynh
    kgsamqdlaevnnfppqswq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gyuA (A:)
    mipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfqlql
    lspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppqswq