PDB entry 1gyu

View 1gyu on RCSB PDB site
Description: gamma-adaptin appendage domain from clathrin adaptor ap1
Deposited on 2002-04-30, released 2002-08-22
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-22, with a file datestamp of 2002-08-22.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.1797
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1gyua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyuA (A:)
    mipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfqlql
    lspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppqswq