PDB entry 1gyr

View 1gyr on RCSB PDB site
Description: mutant form of enoyl thioester reductase from candida tropicalis
Deposited on 2002-04-29, released 2003-03-13
The last revision prior to the SCOP 1.65 freeze date was dated 2003-03-13, with a file datestamp of 2003-03-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.19539
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyrA (A:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvnpsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyrB (B:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvnpsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyrC (C:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvnpsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity