PDB entry 1gyr

View 1gyr on RCSB PDB site
Description: mutant form of enoyl thioester reductase from candida tropicalis
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2002-04-29, released 2003-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.19539
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,4-dienoyl-CoA reductase
    Species: CANDIDA TROPICALIS [TaxId:5482]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WZM3 (0-363)
      • engineered mutation (56)
    Domains in SCOPe 2.08: d1gyra1, d1gyra2
  • Chain 'B':
    Compound: 2,4-dienoyl-CoA reductase
    Species: CANDIDA TROPICALIS [TaxId:5482]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WZM3 (0-363)
      • engineered mutation (56)
    Domains in SCOPe 2.08: d1gyrb1, d1gyrb2
  • Chain 'C':
    Compound: 2,4-dienoyl-CoA reductase
    Species: CANDIDA TROPICALIS [TaxId:5482]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WZM3 (0-363)
      • engineered mutation (56)
    Domains in SCOPe 2.08: d1gyrc1, d1gyrc2
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyrA (A:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvnpsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyrB (B:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvnpsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyrC (C:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvnpsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity