PDB entry 1gyq

View 1gyq on RCSB PDB site
Description: crystal structure of glycosomal glyceraldehyde from leishmania mexicana in complex with n6-benzyl-nad
Class: oxidoreductase
Keywords: oxidoreductase (aldehyde(d)-nad+(a))
Deposited on 1999-03-05, released 1999-03-16
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glyceraldehyde-3-phosphate dehydrogenase)
    Species: Leishmania mexicana
    Gene: GLYCERALDEHYDE-3-PHOSPHATEURCE 6 DEHYDROGENASE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gyqa1, d1gyqa2
  • Chain 'B':
    Compound: protein (glyceraldehyde-3-phosphate dehydrogenase)
    Species: Leishmania mexicana
    Gene: GLYCERALDEHYDE-3-PHOSPHATEURCE 6 DEHYDROGENASE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gyqb1, d1gyqb2
  • Chain 'C':
    Compound: protein (glyceraldehyde-3-phosphate dehydrogenase)
    Species: Leishmania mexicana
    Gene: GLYCERALDEHYDE-3-PHOSPHATEURCE 6 DEHYDROGENASE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gyqc1, d1gyqc2
  • Chain 'D':
    Compound: protein (glyceraldehyde-3-phosphate dehydrogenase)
    Species: Leishmania mexicana
    Gene: GLYCERALDEHYDE-3-PHOSPHATEURCE 6 DEHYDROGENASE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gyqd1, d1gyqd2
  • Heterogens: NBD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyqA (A:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaass
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyqB (B:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaass
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyqC (C:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaass
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyqD (D:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaass