PDB entry 1gyp

View 1gyp on RCSB PDB site
Description: crystal structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from leishmania mexicana: implications for structure-based drug design and a new position for the inorganic phosphate binding site
Class: oxidoreductase (aldehyde(d)-nad+(a))
Keywords: oxidoreductase (aldehyde(d)-nad+(a))
Deposited on 1995-08-01, released 1995-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.198
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: GLYCERALDEHYDE-3-PHOSPHATE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gypa1, d1gypa2
  • Chain 'B':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: GLYCERALDEHYDE-3-PHOSPHATE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gypb1, d1gypb2
  • Chain 'C':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: GLYCERALDEHYDE-3-PHOSPHATE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gypc1, d1gypc2
  • Chain 'D':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: GLYCERALDEHYDE-3-PHOSPHATE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gypd1, d1gypd2
  • Heterogens: PO4, NAD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gypA (A:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaass
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gypB (B:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaass
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gypC (C:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaass
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gypD (D:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaass