PDB entry 1gyp

View 1gyp on RCSB PDB site
Description:
Deposited on 1995-08-01, released 1995-12-07
The last revision prior to the SCOP 1.55 freeze date was dated 1995-12-07, with a file datestamp of 1995-12-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.198
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1gypa1, d1gypa2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1gypb1, d1gypb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1gypc1, d1gypc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1gypd1, d1gypd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gypA (A:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaass
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gypB (B:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaass
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gypC (C:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaass
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gypD (D:)
    apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
    ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
    eghikggakkvvisapasggaktivmgvnqheyspashhvvsnascttnclapivhvltk
    enfgietglmttihsytatqktvdgvslkdwrggraaavniipsttgaakavgmvipstk
    gkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtymkgilgftdeelvsad
    findnrssvydskatlqnnlpgekrffkvvswydnewayshrvvdlvrymaakdaass