PDB entry 1gyn

View 1gyn on RCSB PDB site
Description: class II fructose 1,6-bisphosphate aldolase with cadmium (not zinc) in the active site
Class: lyase
Keywords: lyase, cadmium, aldolase
Deposited on 2002-04-27, released 2003-02-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose-bisphosphate aldolase II
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gyna_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gynA (A:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctgg
    eedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpti
    lrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvl
    nyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gynA (A:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgalyt
    qpedvdyaytelskisprftiaasfgnvvvltptilrdsqeyvskkhnlphnslnfvfhg
    gsgstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqgqlgnpkgedqpnk
    kyydprvwlragqtsmiarlekafqelnaidvl