PDB entry 1gym

View 1gym on RCSB PDB site
Description: phosphatidylinositol-specific phospholipase c in complex with glucosamine-(alpha-1-6)-myo-inositol
Deposited on 1996-05-02, released 1996-11-08
The last revision prior to the SCOP 1.71 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.178
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1gym__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1gym_ (-)
    assvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
    hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
    mkgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpd
    netftttvnqnanvtvqdkykvsydekvksikdtmdetmnnsedlnhlyinftslssggt
    awnspyyyasyinpeianyikqknparvgwviqdyinekwspllyqevirankslike
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gym_ (-)
    assvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
    hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
    mkgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpd
    netftttvnqnanvtvqdkykvsydekvksikdtmdetmnnsedlnhlyinftslssggt
    awnspyyyasyinpeianyikqknparvgwviqdyinekwspllyqeviranksli