PDB entry 1gyk

View 1gyk on RCSB PDB site
Description: serum amyloid p component co-crystallised with mobdg at neutral ph
Class: glycoprotein
Keywords: pentraxin, amyloid lectin, glycoprotein, plasma, polymorphism
Deposited on 2002-04-25, released 2003-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gyka_
  • Chain 'B':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gykb_
  • Chain 'C':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gykc_
  • Chain 'D':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gykd_
  • Chain 'E':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gyke_
  • Heterogens: CA, CDG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gykA (A:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gykB (B:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gykC (C:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gykD (D:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gykE (E:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv