PDB entry 1gyh

View 1gyh on RCSB PDB site
Description: structure of d158a cellvibrio cellulosa alpha-l-arabinanase mutant
Class: hydrolase
Keywords: arabinanase, hydrolase, propeller, catalysis, cellvibrio, pseudomonas
Deposited on 2002-04-23, released 2002-08-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.147
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arabinan endo-1,5-alpha-l-arabinosidase a
    Species: CELLVIBRIO CELLULOSA [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GYH (0-317)
    Domains in SCOPe 2.02: d1gyha_
  • Chain 'B':
    Compound: arabinan endo-1,5-alpha-l-arabinosidase a
    Species: CELLVIBRIO CELLULOSA [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GYH (Start-317)
    Domains in SCOPe 2.02: d1gyhb_
  • Chain 'C':
    Compound: arabinan endo-1,5-alpha-l-arabinosidase a
    Species: CELLVIBRIO CELLULOSA [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GYH (0-317)
    Domains in SCOPe 2.02: d1gyhc_
  • Chain 'D':
    Compound: arabinan endo-1,5-alpha-l-arabinosidase a
    Species: CELLVIBRIO CELLULOSA [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GYH
    Domains in SCOPe 2.02: d1gyhd_
  • Chain 'E':
    Compound: arabinan endo-1,5-alpha-l-arabinosidase a
    Species: CELLVIBRIO CELLULOSA [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GYH (0-317)
    Domains in SCOPe 2.02: d1gyhe_
  • Chain 'F':
    Compound: arabinan endo-1,5-alpha-l-arabinosidase a
    Species: CELLVIBRIO CELLULOSA [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GYH
    Domains in SCOPe 2.02: d1gyhf_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyhA (A:)
    gakqvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsf
    dghlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvp
    qrdlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvl
    mddsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgr
    dmnqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgeg
    wpqvdekeldsyisqrlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gyhB (B:)
    gakqvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsf
    dghlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvp
    qrdlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvl
    mddsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgr
    dmnqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgeg
    wpqvdekeldsyisqrlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gyhB (B:)
    akqvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsfd
    ghlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvpq
    rdlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvlm
    ddsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgrd
    mnqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgegw
    pqvdekeldsyisqrlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyhC (C:)
    gakqvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsf
    dghlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvp
    qrdlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvl
    mddsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgr
    dmnqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgeg
    wpqvdekeldsyisqrlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gyhD (D:)
    gakqvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsf
    dghlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvp
    qrdlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvl
    mddsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgr
    dmnqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgeg
    wpqvdekeldsyisqrlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gyhD (D:)
    akqvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsfd
    ghlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvpq
    rdlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvlm
    ddsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgrd
    mnqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgegw
    pqvdekeldsyisqrl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyhE (E:)
    gakqvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsf
    dghlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvp
    qrdlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvl
    mddsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgr
    dmnqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgeg
    wpqvdekeldsyisqrlk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1gyhF (F:)
    gakqvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsf
    dghlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvp
    qrdlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvl
    mddsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgr
    dmnqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgeg
    wpqvdekeldsyisqrlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gyhF (F:)
    akqvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsfd
    ghlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvpq
    rdlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvlm
    ddsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgrd
    mnqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgegw
    pqvdekeldsyisqrl