PDB entry 1gyh

View 1gyh on RCSB PDB site
Description: structure of d158a cellvibrio cellulosa alpha-l-arabinanase mutant
Deposited on 2002-04-23, released 2002-08-23
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-23, with a file datestamp of 2002-08-23.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.14709
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1gyha_
  • Chain 'B':
    Domains in SCOP 1.61: d1gyhb_
  • Chain 'C':
    Domains in SCOP 1.61: d1gyhc_
  • Chain 'D':
    Domains in SCOP 1.61: d1gyhd_
  • Chain 'E':
    Domains in SCOP 1.61: d1gyhe_
  • Chain 'F':
    Domains in SCOP 1.61: d1gyhf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyhA (A:)
    gakqvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsf
    dghlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvp
    qrdlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvl
    mddsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgr
    dmnqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgeg
    wpqvdekeldsyisqrlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyhB (B:)
    akqvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsfd
    ghlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvpq
    rdlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvlm
    ddsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgrd
    mnqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgegw
    pqvdekeldsyisqrlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyhC (C:)
    gakqvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsf
    dghlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvp
    qrdlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvl
    mddsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgr
    dmnqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgeg
    wpqvdekeldsyisqrlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyhD (D:)
    akqvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsfd
    ghlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvpq
    rdlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvlm
    ddsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgrd
    mnqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgegw
    pqvdekeldsyisqrl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyhE (E:)
    gakqvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsf
    dghlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvp
    qrdlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvl
    mddsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgr
    dmnqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgeg
    wpqvdekeldsyisqrlk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyhF (F:)
    akqvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsfd
    ghlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvpq
    rdlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvlm
    ddsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgrd
    mnqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgegw
    pqvdekeldsyisqrl