PDB entry 1gyf

View 1gyf on RCSB PDB site
Description: gyf domain from human cd2bp2 protein
Class: immune system
Keywords: t cell signaling, proline-rich sequence recognition, adapter domain, immune system
Deposited on 1999-04-30, released 2000-01-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (cytoplasmic domain binding protein (cd2bp2))
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O95400 (0-61)
  Domains in SCOPe 2.03: d1gyfa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gyfA (A:)
  dvmweykwentgdaelygpftsaqmqtwvsegyfpdgvycrkldppggqfynskridfdl
  yt