PDB entry 1gyf

View 1gyf on RCSB PDB site
Description: gyf domain from human cd2bp2 protein
Deposited on 1999-04-30, released 2000-01-05
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-05, with a file datestamp of 2000-01-04.
Experiment type: NMR16
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1gyfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyfA (A:)
    dvmweykwentgdaelygpftsaqmqtwvsegyfpdgvycrkldppggqfynskridfdl
    yt