PDB entry 1gye

View 1gye on RCSB PDB site
Description: structure of cellvibrio cellulosa alpha-l-arabinanase complexed with arabinohexaose
Deposited on 2002-04-23, released 2002-08-23
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-23, with a file datestamp of 2002-08-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.18957
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.61: d1gyeb_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gyeB (B:)
    kqvdvhdpvmtregatwylfstgpgitiysskdrvnwrysdrafateptwakrvspsfdg
    hlwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvpqr
    dlwnaiapaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvlmd
    dsqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgrdm
    nqgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgegwp
    qvdekeldsyisqrl