PDB entry 1gyd

View 1gyd on RCSB PDB site
Description: structure of cellvibrio cellulosa alpha-l-arabinanase
Class: arabinanase
Keywords: arabinanase, hydrolase, propeller, catalysis, cellvibrio, pseudomonas
Deposited on 2002-04-23, released 2002-08-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.207
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: arabinan endo-1,5-alpha-l-arabinosidase a
    Species: CELLVIBRIO CELLULOSA [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GYD (0-314)
    Domains in SCOPe 2.02: d1gydb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gydB (B:)
    qvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsfdgh
    lwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvpqrd
    lwnaidpaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvlmdd
    sqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgrdmn
    qgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgegwpq
    vdekeldsyisqrlk