PDB entry 1gyd

View 1gyd on RCSB PDB site
Description: structure of cellvibrio cellulosa alpha-l-arabinanase
Deposited on 2002-04-23, released 2002-08-23
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-23, with a file datestamp of 2002-08-23.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.20655
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.61: d1gydb_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gydB (B:)
    qvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsfdgh
    lwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvpqrd
    lwnaidpaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvlmdd
    sqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgrdmn
    qgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgegwpq
    vdekeldsyisqrlk