PDB entry 1gyd

View 1gyd on RCSB PDB site
Description: Structure of Cellvibrio cellulosa alpha-L-arabinanase
Class: arabinanase
Keywords: arabinanase, hydrolase, propeller, catalysis, cellvibrio, pseudomonas
Deposited on 2002-04-23, released 2002-08-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: arabinan endo-1,5-alpha-l-arabinosidase a
    Species: CELLVIBRIO CELLULOSA [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GYD (0-314)
    Domains in SCOPe 2.08: d1gydb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gydB (B:)
    qvdvhdpvmtregdtwylfstgpgitiysskdrvnwrysdrafateptwakrvspsfdgh
    lwapdiyqhkglfylyysvsafgkntsaigvtvnktlnpaspdyrwedkgiviesvpqrd
    lwnaidpaiiaddhgqvwmsfgsfwgglklfklnddltrpaepqewhsiaklersvlmdd
    sqagsaqieapfilrkgdyyylfaswglccrkgdstyhlvvgrskqvtgpyldktgrdmn
    qgggsllikgnkrwvglghnsaytwdgkdylvlhayeaadnylqklkilnlhwdgegwpq
    vdekeldsyisqrlk