PDB entry 1gya

View 1gya on RCSB PDB site
Description: n-glycan and polypeptide nmr solution structures of the adhesion domain of human cd2
Deposited on 1995-05-26, released 1996-11-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1gya__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gya_ (-)
  keitnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdty
  klfkngtlkikhlktddqdiykvsiydtkgknvlekifdlkiqer