PDB entry 1gy9

View 1gy9 on RCSB PDB site
Description: taurine/alpha-ketoglutarate dioxygenase from escherichia coli
Class: oxidoreductase
Keywords: oxidoreductase, taurine, sulphur metabolism, oxygenase, alpha-ketoglutarate, taud, tfda
Deposited on 2002-04-22, released 2002-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.264
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-Ketoglutarate-Dependent Taurine Dioxygenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gy9a_
  • Chain 'B':
    Compound: Alpha-Ketoglutarate-Dependent Taurine Dioxygenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gy9b_
  • Heterogens: FE, TAU, AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gy9A (A:)
    mserlsitplgpyigaqisgadltrplsdnqfeqlyhavlrhqvvflrdqaitpqqqral
    aqrfgelhihpvyphaegvdeiivldthndnppdndnwhtdvtfietppagailaakelp
    stggdtlwtsgiaayealsvpfrqllsglraehdfrksfpeykyrkteeehqrwreavak
    nppllhpvvrthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqvrwrw
    qpndiaiwdnrvtqhyanadylpqrrimhratilgdkpfyrag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gy9A (A:)
    rlsitplgpyigaqisgadltrplsdnqfeqlyhavlrhqvvflrdqaitpqqqralaqr
    fgelhihpvyphaegvdeiivldthndnppdndnwhtdvtfietppagailaakelpstg
    gdtlwtsgiaayealsvpfrqllsglraehdfrksfpeykyrkteeehqrwreavaknpp
    llhpvvrthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqvrwrwqpn
    diaiwdnrvtqhyanadylpqrrimhratilgdkpfyra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gy9B (B:)
    mserlsitplgpyigaqisgadltrplsdnqfeqlyhavlrhqvvflrdqaitpqqqral
    aqrfgelhihpvyphaegvdeiivldthndnppdndnwhtdvtfietppagailaakelp
    stggdtlwtsgiaayealsvpfrqllsglraehdfrksfpeykyrkteeehqrwreavak
    nppllhpvvrthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqvrwrw
    qpndiaiwdnrvtqhyanadylpqrrimhratilgdkpfyrag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gy9B (B:)
    erlsitplgpyigaqisgadltrplsdnqfeqlyhavlrhqvvflrdqaitpqqqralaq
    rfgelhihpvyphaegvdeiivldthndnppdndnwhtdvtfietppagailaakelpst
    ggdtlwtsgiaayealsvpfrqllsglraehdfrksfpeykyehqrwreavaknppllhp
    vvrthpvsgkqalfvnegfttrivdvsekeseallsflfahitkpefqvrwrwqpndiai
    wdnrvtqhyanadylpqrrimhratilgdkpfyra