PDB entry 1gy8

View 1gy8 on RCSB PDB site
Description: trypanosoma brucei udp-galactose 4' epimerase
Class: oxidoreductase
Keywords: epimerase, galactose, trypanosoma brucei, oxidoreductase
Deposited on 2002-04-21, released 2003-05-22
The last revision prior to the SCOP 1.75 freeze date was dated 2003-05-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-galactose 4-epimerase
    Species: Trypanosoma brucei
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gy8a_
  • Chain 'B':
    Compound: udp-galactose 4-epimerase
    Species: Trypanosoma brucei
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gy8b_
  • Chain 'C':
    Compound: udp-galactose 4-epimerase
    Species: Trypanosoma brucei
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gy8c_
  • Chain 'D':
    Compound: udp-galactose 4-epimerase
    Species: Trypanosoma brucei
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gy8d_
  • Heterogens: NAD, UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gy8A (A:)
    shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
    gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
    vvgilrllqamllhkcdkiifsssaaifgnptmgsvstnaepidinakkspespygeskl
    iaermirdcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiapdq
    rltihedastdkrmpifgtdyptpdgtcvrdyvhvcdlasahilaldyveklgpndksky
    fsvfnlgtsrgysvrevievarkttghpipvrecgrregdpaylvaasdkarevlgwkpk
    ydtleaimetswkfqrthpngyasqengtpggrttkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gy8A (A:)
    shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
    gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
    vvgilrllqamllhkcdkiifsssaaifgnptmnaepidinakkspespygeskliaerm
    irdcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiapddkrmpi
    fgtdyptpdgtcvrdyvhvcdlasahilaldyveklgpndkskyfsvfnlgtsrgysvre
    vievarkttghpipvrecgrregdpaylvaasdkarevlgwkpkydtleaimetswkfqr
    thpngya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gy8B (B:)
    shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
    gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
    vvgilrllqamllhkcdkiifsssaaifgnptmgsvstnaepidinakkspespygeskl
    iaermirdcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiapdq
    rltihedastdkrmpifgtdyptpdgtcvrdyvhvcdlasahilaldyveklgpndksky
    fsvfnlgtsrgysvrevievarkttghpipvrecgrregdpaylvaasdkarevlgwkpk
    ydtleaimetswkfqrthpngyasqengtpggrttkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gy8B (B:)
    shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
    gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
    vvgilrllqamllhkcdkiifsssaaifgnptmtnaepidinakkspespygeskliaer
    mirdcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiadkrmpif
    gtdyptpdgtcvrdyvhvcdlasahilaldyveklgpndkskyfsvfnlgtsrgysvrev
    ievarkttghpipvrecgrregdpaylvaasdkarevlgwkpkydtleaimetswkfqrt
    hpngya
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gy8C (C:)
    shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
    gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
    vvgilrllqamllhkcdkiifsssaaifgnptmgsvstnaepidinakkspespygeskl
    iaermirdcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiapdq
    rltihedastdkrmpifgtdyptpdgtcvrdyvhvcdlasahilaldyveklgpndksky
    fsvfnlgtsrgysvrevievarkttghpipvrecgrregdpaylvaasdkarevlgwkpk
    ydtleaimetswkfqrthpngyasqengtpggrttkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gy8C (C:)
    shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
    gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
    vvgilrllqamllhkcdkiifsssaaifgnptmnaepidinakkspespygeskliaerm
    irdcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiapdastdkr
    mpifgtdyptpdgtcvrdyvhvcdlasahilaldyveklgpndkskyfsvfnlgtsrgys
    vrevievarkttghpipvrecgrregdpaylvaasdkarevlgwkpkydtleaimetswk
    fqrthpngya
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gy8D (D:)
    shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
    gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
    vvgilrllqamllhkcdkiifsssaaifgnptmgsvstnaepidinakkspespygeskl
    iaermirdcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiapdq
    rltihedastdkrmpifgtdyptpdgtcvrdyvhvcdlasahilaldyveklgpndksky
    fsvfnlgtsrgysvrevievarkttghpipvrecgrregdpaylvaasdkarevlgwkpk
    ydtleaimetswkfqrthpngyasqengtpggrttkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gy8D (D:)
    shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
    gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
    vvgilrllqamllhkcdkiifsssaaifgnptnaepidinakkspespygeskliaermi
    rdcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiadkrmpifgt
    dyptpdgtcvrdyvhvcdlasahilaldyveklgpndkskyfsvfnlgtsrgysvrevie
    varkttghpipvrecgrregdpaylvaasdkarevlgwkpkydtleaimetswkfqrthp
    ngya