PDB entry 1gy2

View 1gy2 on RCSB PDB site
Description: crystal structure of met148leu rusticyanin
Class: electron transport
Keywords: s86d, m148l, rusticyanin, mutant, metal-binding, electron transport, periplasmic
Deposited on 2002-04-16, released 2002-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.184
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rusticyanin
    Species: THIOBACILLUS FERROOXIDANS [TaxId:920]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7JAQ0 (0-154)
      • engineered mutation (147)
      • conflict (123)
    Domains in SCOPe 2.07: d1gy2a_
  • Chain 'B':
    Compound: rusticyanin
    Species: THIOBACILLUS FERROOXIDANS [TaxId:920]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7JAQ0 (0-154)
      • engineered mutation (147)
      • conflict (123)
    Domains in SCOPe 2.07: d1gy2b_
  • Heterogens: CU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gy2A (A:)
    gtldttwkeatlpqvkamlekdtgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkk
    nptleipagatvdvtfintnkgfghsfditkkgppyavmpvidpivagtgfspvpkdgkf
    gytnftwhptagtyyyvcqipghaatglfgkivvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gy2B (B:)
    gtldttwkeatlpqvkamlekdtgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkk
    nptleipagatvdvtfintnkgfghsfditkkgppyavmpvidpivagtgfspvpkdgkf
    gytnftwhptagtyyyvcqipghaatglfgkivvk