PDB entry 1gxr

View 1gxr on RCSB PDB site
Description: WD40 Region of Human Groucho/TLE1
Class: transcription
Keywords: transcriptional co-repressor, wd40, transcription repressor, wd repeat, transcription
Deposited on 2002-04-10, released 2002-06-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.229
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transducin-like enhancer protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GXR (0-8)
      • see remark 999 (30-31)
    • Uniprot Q04724 (9-336)
    Domains in SCOPe 2.06: d1gxra_
  • Chain 'B':
    Compound: transducin-like enhancer protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GXR (0-8)
      • see remark 999 (30-31)
    • Uniprot Q04724 (9-336)
    Domains in SCOPe 2.06: d1gxrb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gxrA (A:)
    dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
    nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
    lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
    ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
    vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
    fqskesssvlscdisvddkyivtgsgdkkatvyeviy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gxrA (A:)
    dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
    nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
    lsiwdlaaprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqgh
    tdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewlavg
    messnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasifq
    skesssvlscdisvddkyivtgsgdkkatvyeviy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gxrB (B:)
    dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
    nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
    lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
    ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
    vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
    fqskesssvlscdisvddkyivtgsgdkkatvyeviy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gxrB (B:)
    dyfqgamgskpaysfhvmqpvpfppdaligpgiprharqintlnhgevvcavtisnptrh
    vytggkgcvkvwdishkspvsqldclnrdnyirsckllpdgctlivggeastlsiwdlap
    rikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqghtdgascidi
    sndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewlavgmessnvevl
    hkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasifqskesssvlscd
    isvddkyivtgsgdkkatvyeviy