PDB entry 1gxr

View 1gxr on RCSB PDB site
Description: wd40 region of human groucho/tle1
Deposited on 2002-04-10, released 2002-06-13
The last revision prior to the SCOP 1.71 freeze date was dated 2002-06-13, with a file datestamp of 2002-06-13.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.229
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1gxra_
  • Chain 'B':
    Domains in SCOP 1.71: d1gxrb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gxrA (A:)
    dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
    nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
    lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
    ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
    vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
    fqskesssvlscdisvddkyivtgsgdkkatvyeviy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gxrA (A:)
    dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
    nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
    lsiwdlaaprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqgh
    tdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewlavg
    messnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasifq
    skesssvlscdisvddkyivtgsgdkkatvyeviy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gxrB (B:)
    dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
    nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
    lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
    ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
    vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
    fqskesssvlscdisvddkyivtgsgdkkatvyeviy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gxrB (B:)
    dyfqgamgskpaysfhvmqpvpfppdaligpgiprharqintlnhgevvcavtisnptrh
    vytggkgcvkvwdishkspvsqldclnrdnyirsckllpdgctlivggeastlsiwdlap
    rikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqghtdgascidi
    sndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewlavgmessnvevl
    hkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasifqskesssvlscd
    isvddkyivtgsgdkkatvyeviy