PDB entry 1gxq

View 1gxq on RCSB PDB site
Description: Crystal structure of the PhoB effector domain
Class: transcriptional activator
Keywords: transcriptional activator, helix-winged-helix, sensory transduction, phosphorylation, DNA binding, activator, two-component signal transduction
Deposited on 2002-04-08, released 2002-04-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phosphate regulon transcriptional regulatory protein phob
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AFJ5 (Start-105)
  Domains in SCOPe 2.06: d1gxqa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1gxqA (A:)
  spmaveeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhv
  wgtnvyvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1gxqA (A:)
  pmaveeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhvw
  gtnvyvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf