PDB entry 1gxq

View 1gxq on RCSB PDB site
Description: Crystal structure of the PhoB effector domain
Class: transcriptional activator
Keywords: transcriptional activator, helix-winged-helix, sensory transduction, phosphorylation, DNA binding, activator, two-component signal transduction
Deposited on 2002-04-08, released 2002-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphate regulon transcriptional regulatory protein phob
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gxqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gxqA (A:)
    spmaveeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhv
    wgtnvyvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gxqA (A:)
    pmaveeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhvw
    gtnvyvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf