PDB entry 1gxp

View 1gxp on RCSB PDB site
Description: phob effector domain in complex with pho box DNA.
Class: transcriptional activator
Keywords: transcriptional activator, helix-winged-helix, sensory transduction, phosphorylation, DNA binding, activator, two- component signal transduction
Deposited on 2002-04-08, released 2002-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.247
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphate regulon transcriptional regulatory protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gxpa_
  • Chain 'B':
    Compound: phosphate regulon transcriptional regulatory protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gxpb_
  • Chain 'C':
    Compound: 5'-d(*gp*ap*gp*cp*tp*gp*tp*cp*ap*tp* ap*ap*ap*gp*tp*tp*gp*tp*cp*ap*cp*gp*g)-3'
  • Chain 'D':
    Compound: 5'-d(*cp*cp*cp*gp*tp*gp*ap*cp*ap*ap* cp*tp*tp*tp*ap*tp*gp*ap*cp*ap*gp*cp*t)-3'
  • Chain 'E':
    Compound: phosphate regulon transcriptional regulatory protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gxpe_
  • Chain 'F':
    Compound: phosphate regulon transcriptional regulatory protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gxpf_
  • Chain 'G':
    Compound: 5'-d(*gp*ap*gp*cp*tp*gp*tp*cp*ap*tp* ap*ap*ap*gp*tp*tp*gp*tp*cp*ap*cp*gp*g)-3'
  • Chain 'H':
    Compound: 5'-d(*cp*cp*cp*gp*tp*gp*ap*cp*ap*ap* cp*tp*tp*tp*ap*tp*gp*ap*cp*ap*gp*cp*t)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gxpA (A:)
    spmaveeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhv
    wgtnvyvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gxpA (A:)
    aveeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhvwgt
    nvyvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gxpB (B:)
    spmaveeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhv
    wgtnvyvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gxpB (B:)
    eeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhvwgtnv
    yvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1gxpE (E:)
    spmaveeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhv
    wgtnvyvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gxpE (E:)
    veeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhvwgtn
    vyvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1gxpF (F:)
    spmaveeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhv
    wgtnvyvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gxpF (F:)
    veeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhvwgtn
    vyvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.