PDB entry 1gxo

View 1gxo on RCSB PDB site
Description: mutant d189a of family 10 polysaccharide lyase from cellvibrio cellulosa in complex with trigalaturonic acid
Class: lyase
Keywords: lyase, pectate, mechanism, elimination
Deposited on 2002-04-08, released 2002-10-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.176
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pectate lyase
    Species: CELLVIBRIO CELLULOSA [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GXO
      • engineered mutation (71)
    • Uniprot Q9F7L3
    Domains in SCOPe 2.06: d1gxoa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gxoA (A:)
    glvprgshmtgrmltldgnpaanwlnnartkwsasradvvlsyqqnnggwpknldynsvg
    nggggnesgtiangatitemvflaevyksggntkyrdavrkaanflvnsqystgalpqfy
    plkggysdhatfndngmayaltvldfaankrapfdtdvfsdndrtrfktavtkgtdyilk
    aqwkqngvltvwcaqhgaldyqpkkarayeleslsgsesvgvlaflmtqpqtaeieqavr
    agvawfnsprtylegytydsslaatnpivpragskmwyrfydlntnrgffsdrdgskfyd
    itqmslerrtgyswggnygtsiinfaqkvgyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gxoA (A:)
    rmltldgnpaanwlnnartkwsasradvvlsyqqnnggwpknldynsvgnggggnesgti
    angatitemvflaevyksggntkyrdavrkaanflvnsqystgalpqfyplkggysdhat
    fndngmayaltvldfaankrapfdtdvfsdndrtrfktavtkgtdyilkaqwkqngvltv
    wcaqhgaldyqpkkarayeleslsgsesvgvlaflmtqpqtaeieqavragvawfnsprt
    ylegytydsslaatnpivpragskmwyrfydlntnrgffsdrdgskfyditqmslerrtg
    yswggnygtsiinfaqkvgy