PDB entry 1gxn

View 1gxn on RCSB PDB site
Description: family 10 polysaccharide lyase from cellvibrio cellulosa
Class: lyase
Keywords: lyase, pectate, mechanism, elimination
Deposited on 2002-04-08, released 2002-10-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.131
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pectate lyase
    Species: CELLVIBRIO CELLULOSA [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GXN
      • conflict (161)
      • conflict (236)
    • Uniprot Q9F7L3 (9-331)
    Domains in SCOPe 2.06: d1gxna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gxnA (A:)
    glvprgshmtgrmltldgnpaanwlnnartkwsasradvvlsyqqnnggwpknldynsvg
    nggggnesgtidngatitemvflaevyksggntkyrdavrkaanflvnsqystgalpqfy
    plkggysdhatfndngmayaltvldfaankrapfdtdvfsdndrtrfktavtkgtdyilk
    aqwkqngvltvwcaqhgaldyqpkkarayeleslsgsesvgvlaflmtqpqtaeieqavr
    agvawfnsprtylegytydsslaatnpivpragskmwyrfydlntnrgffsdrdgskfyd
    itqmslerrtgyswggnygtsiinfaqkvgyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gxnA (A:)
    tgrmltldgnpaanwlnnartkwsasradvvlsyqqnnggwpknldynsvgnggggnesg
    tidngatitemvflaevyksggntkyrdavrkaanflvnsqystgalpqfyplkggysdh
    atfndngmayaltvldfaankrapfdtdvfsdndrtrfktavtkgtdyilkaqwkqngvl
    tvwcaqhgaldyqpkkarayeleslsgsesvgvlaflmtqpqtaeieqavragvawfnsp
    rtylegytydsslaatnpivpragskmwyrfydlntnrgffsdrdgskfyditqmslerr
    tgyswggnygtsiinfaqkvgyl