PDB entry 1gxm

View 1gxm on RCSB PDB site
Description: family 10 polysaccharide lyase from cellvibrio cellulosa
Class: lyase
Keywords: lyase, pectate, elimination
Deposited on 2002-04-08, released 2002-10-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.132
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pectate lyase
    Species: CELLVIBRIO CELLULOSA [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GXM (Start-8)
      • conflict (161)
      • conflict (236)
    • Uniprot Q9F7L3 (9-331)
    Domains in SCOPe 2.06: d1gxma1, d1gxma2
  • Chain 'B':
    Compound: pectate lyase
    Species: CELLVIBRIO CELLULOSA [TaxId:155077]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GXM (0-8)
      • conflict (161)
      • conflict (236)
    • Uniprot Q9F7L3 (9-331)
    Domains in SCOPe 2.06: d1gxmb1, d1gxmb2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gxmA (A:)
    glvprgshmtgrmltldgnpaanwlnnartkwsasradvvlsyqqnnggwpknldynsvg
    nggggnesgtidngatitemvflaevyksggntkyrdavrkaanflvnsqystgalpqfy
    plkggysdhatfndngmayaltvldfaankrapfdtdvfsdndrtrfktavtkgtdyilk
    aqwkqngvltvwcaqhgaldyqpkkarayeleslsgsesvgvlaflmtqpqtaeieqavr
    agvawfnsprtylegytydsslaatnpivpragskmwyrfydlntnrgffsdrdgskfyd
    itqmslerrtgyswggnygtsiinfaqkvgyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gxmA (A:)
    mtgrmltldgnpaanwlnnartkwsasradvvlsyqqnnggwpknldynsvgnggggnes
    gtidngatitemvflaevyksggntkyrdavrkaanflvnsqystgalpqfyplkggysd
    hatfndngmayaltvldfaankrapfdtdvfsdndrtrfktavtkgtdyilkaqwkqngv
    ltvwcaqhgaldyqpkkarayeleslsgsesvgvlaflmtqpqtaeieqavragvawfns
    prtylegytydsslaatnpivpragskmwyrfydlntnrgffsdrdgskfyditqmsler
    rtgyswggnygtsiinfaqkvgyl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gxmB (B:)
    glvprgshmtgrmltldgnpaanwlnnartkwsasradvvlsyqqnnggwpknldynsvg
    nggggnesgtidngatitemvflaevyksggntkyrdavrkaanflvnsqystgalpqfy
    plkggysdhatfndngmayaltvldfaankrapfdtdvfsdndrtrfktavtkgtdyilk
    aqwkqngvltvwcaqhgaldyqpkkarayeleslsgsesvgvlaflmtqpqtaeieqavr
    agvawfnsprtylegytydsslaatnpivpragskmwyrfydlntnrgffsdrdgskfyd
    itqmslerrtgyswggnygtsiinfaqkvgyl