PDB entry 1gxi

View 1gxi on RCSB PDB site
Description: psae sub-unit of the photosystem I of the cyanobacterium synechocystis sp. pcc 6803
Class: photosynthesis
Keywords: photosynthesis, photosystem I, psae sub-unit, thylakoid
Deposited on 2002-04-05, released 2003-04-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: photosystem I reaction center subunit IV
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1gxie_

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gxiE (E:)
    alnrgdkvrikrtesywygdvgtvasveksgilypvivrfdrvnyngfsgsasgvntnnf
    aenelelvqaaak