PDB entry 1gxh

View 1gxh on RCSB PDB site
Description: colicin e8 DNAse immunity protein: im8
Class: inhibitor
Keywords: inhibitor protein of DNAse colicin e8, bacteriocin immunity, plasmid, DNAse inhibitor
Deposited on 2002-04-05, released 2002-05-01
The last revision prior to the SCOP 1.73 freeze date was dated 2002-05-01, with a file datestamp of 2007-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: colicin e8 immunity protein
  Species: ESCHERICHIA COLI
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09881 (0-84)
  Domains in SCOP 1.73: d1gxha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gxhA (A:)
  melknsisdytetefkkiiediincegdekkqddnlehfisvtehpsgsdliyypegnnd
  gspeavikeikewraangksgfkqg