PDB entry 1gx9

View 1gx9 on RCSB PDB site
Description: bovine beta-lactoglobulin complexed with retinoic acid, trigonal lattice z
Class: lipocalin
Keywords: lipocalin, milk ,whey transport, bovine, retinol-binding allergen, signal, 3d-structure, retinoic acid-binding
Deposited on 2002-03-29, released 2002-06-13
The last revision prior to the SCOP 1.73 freeze date was dated 2002-06-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.2271
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactoglobulin
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1gx9a_
  • Heterogens: REA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gx9A (A:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gx9A (A:)
    ivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkw
    engecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqc
    lvrtpevddealekfdkalkalpmhirlsfnptqleeqchi