PDB entry 1gx3

View 1gx3 on RCSB PDB site
Description: m. smegmatis arylamine n-acetyl transferase
Deposited on 2002-03-26, released 2002-06-13
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-13, with a file datestamp of 2002-06-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.211
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1gx3a_
  • Chain 'B':
    Domains in SCOP 1.61: d1gx3b_
  • Chain 'C':
    Domains in SCOP 1.61: d1gx3c_
  • Chain 'D':
    Domains in SCOP 1.61: d1gx3d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gx3A (A:)
    gmamdlggyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaealfa
    klvdrrrggycyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvavpg
    adgrylvdvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqplytf
    tteprpridlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehirf
    dsaaqvldaivnrfgidlgdlagrdvqarvaevldt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gx3B (B:)
    amdlggyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaealfakl
    vdrrrggycyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvavpgad
    grylvdvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqplytftt
    eprpridlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehirfds
    aaqvldaivnrfgidlgdlagrdvqarvaevldt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gx3C (C:)
    amdlggyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaealfakl
    vdrrrggycyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvavpgad
    grylvdvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqplytftt
    eprpridlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehirfds
    aaqvldaivnrfgidlgdlagrdvqarvaevldt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gx3D (D:)
    amdlggyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaealfakl
    vdrrrggycyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvavpgad
    grylvdvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqplytftt
    eprpridlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehirfds
    aaqvldaivnrfgidlgdlagrdvqarvaevldt